DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and CP33

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_190806.1 Gene:CP33 / 824403 AraportID:AT3G52380 Length:329 Species:Arabidopsis thaliana


Alignment Length:243 Identity:67/243 - (27%)
Similarity:113/243 - (46%) Gaps:36/243 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DESADVIVLADREEDDICELEHLR-------KLFIGGLAPYT-TEENLKLFYGQWGKVVDVVVMR 65
            :|..:|....|..|:::.|.:...       :|::|.| ||| |...|...:|:.|.||||.::.
plant    86 EEEEEVEEEGDEGEEEVEEEKQTTQASGEEGRLYVGNL-PYTITSSELSQIFGEAGTVVDVQIVY 149

  Fly    66 DAATKRSRGFGFITYTKSLMVDRAQENRPHI----IDGKTVEAK-RALPR-PERESRETNI---- 120
            |..|.|||||||:|...   ::.|:|.....    |.|:||:.. ..:|| .|.|...|.|    
plant   150 DKVTDRSRGFGFVTMGS---IEEAKEAMQMFNSSQIGGRTVKVNFPEVPRGGENEVMRTKIRDNN 211

  Fly   121 -----SVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKA 180
                 |..|::.|.|..|...:.|::.|.....|:..|::.::.||:.|||.|:.|:..:.|..|
plant   212 RSYVDSPHKVYAGNLGWNLTSQGLKDAFGDQPGVLGAKVIYERNTGRSRGFGFISFESAENVQSA 276

  Fly   181 ILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGLANAIKPSLNQQQQQQ 228
            :.    .:..|.|:.:....|| ..|:::|    ....||:.:.:.::
plant   277 LA----TMNGVEVEGRALRLNL-ASEREKP----TVSPPSVEEGETEE 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 30/82 (37%)
RRM2_hnRNPA_like 124..196 CDD:240774 19/71 (27%)
CP33NP_190806.1 RRM_HP0827_like 117..193 CDD:240845 30/79 (38%)
RRM_SF 220..295 CDD:302621 21/79 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.