DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and NUC-L2

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_188491.1 Gene:NUC-L2 / 821392 AraportID:AT3G18610 Length:636 Species:Arabidopsis thaliana


Alignment Length:218 Identity:56/218 - (25%)
Similarity:94/218 - (43%) Gaps:54/218 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDEPLSDESADVIVLADREED--------------DICELEH-----------------LRKLFI 36
            |.|..||||:|.   :|:||.              ::.:.|.                 .:.||.
plant   327 KQESSSDESSDE---SDKEESKDEKVTPKKKDSDVEMVDAEQKSNAKQPKTPTNQTQGGSKTLFA 388

  Fly    37 GGLAPYTTEENLKLFYGQWGKVVDVVV--MRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDG 99
            |.|:......:::.|:.:.|:||||.:  ..|.:.|   |:|.|.:.......:|.|....::.|
plant   389 GNLSYQIARSDIENFFKEAGEVVDVRLSSFDDGSFK---GYGHIEFASPEEAQKALEMNGKLLLG 450

  Fly   100 KTVEA----KRALPR---PERE---SRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKL 154
            :.|..    :|..||   |.|:   |:...|.|:. |...|.::..::.||.:|.:.|.|..|.:
plant   451 RDVRLDLANERGTPRNSNPGRKGEGSQSRTIYVRG-FSSSLGEDEIKKELRSHFSKCGEVTRVHV 514

  Fly   155 LTDKTTGKRRGFAFVE----FDD 173
            .||:.||..||||:::    ||:
plant   515 PTDRETGASRGFAYIDLTSGFDE 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 20/82 (24%)
RRM2_hnRNPA_like 124..196 CDD:240774 18/54 (33%)
NUC-L2NP_188491.1 RRM1_NUCLs 385..461 CDD:409884 19/78 (24%)
RRM2_NUCLs 480..556 CDD:409885 20/59 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.