DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and AT3G06970

DIOPT Version :10

Sequence 1:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_187353.2 Gene:AT3G06970 / 819882 AraportID:AT3G06970 Length:317 Species:Arabidopsis thaliana


Alignment Length:157 Identity:45/157 - (28%)
Similarity:65/157 - (41%) Gaps:34/157 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 VKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQH 186
            |.|:|||.|......:.||.||.|||.||...::::...|:.:|:.|:.|.||.:..:|:...:.
plant    11 VTKIFVGNLTWRTTADDLRRYFEQFGQVVDANVVSETYPGRSKGYGFITFRDYVSTVRALQNSKP 75

  Fly   187 AIKYVHVDVKKSIYNLDKKEKQQPGGLANAIKPSLNQQQQQQGGGQQPPNGNMQAPSFRPPVPPQ 251
            .|     |.:.:..||     ...|...|...|:||                   .||...:||.
plant    76 II-----DGRTTNCNL-----ASAGAKQNMNHPNLN-------------------GSFNYVIPPH 111

  Fly   252 QAMGPYQQQPPPAPMSAPPPNFNY-WG 277
            |    |||.|.......||..:|: ||
plant   112 Q----YQQAPQHVIPYCPPHTWNHVWG 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766 23/71 (32%)
RRM_SF 33..110 CDD:473069
AT3G06970NP_187353.2 PABP-1234 <3..182 CDD:130689 45/157 (29%)
RRM_SF 12..87 CDD:473069 25/84 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.