DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and AT2G41060

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001078035.1 Gene:AT2G41060 / 818705 AraportID:AT2G41060 Length:451 Species:Arabidopsis thaliana


Alignment Length:381 Identity:86/381 - (22%)
Similarity:134/381 - (35%) Gaps:121/381 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDEPLSD---------------ESAD--------VIVLADREEDDICELEHLRKLFIGGLAPYTT 44
            ::||:.|               |:|:        :.::||.      :|.| ||:|:.||...|.
plant    83 EEEPIEDLLEPFSKDQLLILLKEAAERHRDVANRIRIVADE------DLVH-RKIFVHGLGWDTK 140

  Fly    45 EENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPH-------------- 95
            .::|...:.|:|::.|...:.|..:.:|:|:|||.: ||....|....:|.              
plant   141 ADSLIDAFKQYGEIEDCKCVVDKVSGQSKGYGFILF-KSRSGARNALKQPQKKIGTRMTACQLAS 204

  Fly    96 --IIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDK 158
              .:.|..|.|......||...|       |::|..:..:.|.:.|.|:|.:||.:....|..||
plant   205 IGPVQGNPVVAPAQHFNPENVQR-------KIYVSNVSADIDPQKLLEFFSRFGEIEEGPLGLDK 262

  Fly   159 TTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHV-----------DVKKSIYNLDKKEKQQ--- 209
            .||:.:|||...:...::..|| |::.|.....||           .||:..:|.:...:..   
plant   263 ATGRPKGFALFVYRSLESAKKA-LEEPHKTFEGHVLHCHKANDGPKQVKQHQHNHNSHNQNSRYQ 326

  Fly   210 ---------PGG----------LANAIKPSLNQQ----QQQQGGG-----------------QQP 234
                     |||          ...|..|::.|.    ...||.|                 ..|
plant   327 RNDNNGYGAPGGHGHFIAGNNQAVQAFNPAIGQALTALLASQGAGLGLNQAFGQALLGTLGTASP 391

  Fly   235 ------PNGNMQAPSFRPPVPP---QQA--MGPYQ-QQPPPAPMSAPPPNFNYWGP 278
                  |:|.....:..|.|.|   .||  .|.|| |||.............|.||
plant   392 GAVGGMPSGYGTQANISPGVYPGYGAQAGYQGGYQTQQPGQGGAGRGQHGAGYGGP 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 22/92 (24%)
RRM2_hnRNPA_like 124..196 CDD:240774 22/82 (27%)
AT2G41060NP_001078035.1 RRM_SF 128..203 CDD:302621 20/75 (27%)
RRM_RBM24_RBM38_like 227..302 CDD:240830 23/82 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.