DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and AT2G37220

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_181259.1 Gene:AT2G37220 / 818299 AraportID:AT2G37220 Length:289 Species:Arabidopsis thaliana


Alignment Length:211 Identity:58/211 - (27%)
Similarity:94/211 - (44%) Gaps:34/211 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 DEPLSDESADVIVLA--DREEDDICELEHLR--------KLFIGGLAPYTTEE-NLKLFYGQWGK 57
            :.|.|..:.:|.:.:  :.|||...::...:        |||:|.| |:..:. .|...:...|.
plant    53 NSPASRFARNVAITSEFEVEEDGFADVAPPKEQSFSADLKLFVGNL-PFNVDSAQLAQLFESAGN 116

  Fly    58 VVDVVVMRDAATKRSRGFGFITYTKSLMVD-RAQENRPHIIDGKTVEAKRALPRPERE---SRET 118
            |..|.|:.|..|.|||||||:|.:....|: .||:...:.:||:.:......|.|:||   ||..
plant   117 VEMVEVIYDKITGRSRGFGFVTMSSVSEVEAAAQQFNGYELDGRPLRVNAGPPPPKREDGFSRGP 181

  Fly   119 NISV------------------KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRG 165
            ..|.                  .:::||.|....|:..|...|.:.|.||..:::.|:.:|:.:|
plant   182 RSSFGSSGSGYGGGGGSGAGSGNRVYVGNLSWGVDDMALESLFSEQGKVVEARVIYDRDSGRSKG 246

  Fly   166 FAFVEFDDYDAVDKAI 181
            |.||.:|....|..||
plant   247 FGFVTYDSSQEVQNAI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 26/78 (33%)
RRM2_hnRNPA_like 124..196 CDD:240774 19/58 (33%)
AT2G37220NP_181259.1 RRM_SF 92..170 CDD:418427 26/78 (33%)
RRM2_NsCP33_like 205..280 CDD:410187 19/58 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.