DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and AT2G22100

DIOPT Version :10

Sequence 1:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_565526.1 Gene:AT2G22100 / 816745 AraportID:AT2G22100 Length:382 Species:Arabidopsis thaliana


Alignment Length:44 Identity:11/44 - (25%)
Similarity:23/44 - (52%) Gaps:8/44 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   247 LVIKCAEELKCEPKDIRLYFDG----ELVG---NNDKPEDLDLE 283
            ||:.|.:.. |..|::..:::.    :|:|   ...:|.||:|:
plant    23 LVVVCRQRY-CRTKNLLTHYNNKPTVDLIGAMETQSEPSDLELD 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766
RRM_SF 33..110 CDD:473069
AT2G22100NP_565526.1 PABP-1234 <164..>353 CDD:130689
RRM_SF 165..235 CDD:473069
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.