DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and Hnrnpd

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_077380.2 Gene:Hnrnpd / 79256 RGDID:620365 Length:353 Species:Rattus norvegicus


Alignment Length:317 Identity:100/317 - (31%)
Similarity:147/317 - (46%) Gaps:74/317 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 PLSDESADVIVLADREEDDICELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATK 70
            |...|:|    .|.|||         .|:|||||:..||:::||.::.::|.|||..:..|..|.
  Rat    82 PRHTEAA----TAQREE---------WKMFIGGLSWDTTKKDLKDYFSKFGDVVDCTLKLDPITG 133

  Fly    71 RSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHD 135
            |||||||:.:.:|..||:..:.:.|.::||.::.|||      ::.:|...|||:|||||..:..
  Rat   134 RSRGFGFVLFKESESVDKVMDQKEHKLNGKVIDPKRA------KAMKTKEPVKKIFVGGLSPDTP 192

  Fly   136 EECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIY 200
            ||.:||||..||.|.|::|..|..|.|||||.|:.|.:.:.|.|.:.||.|.:.....::|.::.
  Rat   193 EEKIREYFGGFGEVESIELPMDNKTNKRRGFCFITFKEEEPVKKIMEKKYHNVGLSKCEIKVAMS 257

  Fly   201 NLDKKEKQQ---PGGLANAIK-----PSLNQQQ-----QQQGGGQQPPNGNMQAPSFRPPVPPQQ 252
            ....:::||   .||.|...:     ||.|..|     ..||.|....|              .|
  Rat   258 KEQYQQQQQWGSRGGFAGRARGRGGGPSQNWNQGYSNYWNQGYGSYGYN--------------SQ 308

  Fly   253 AMGPYQQQPPPAPMSAPPPNFNYWGPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGW 309
            ..|.|             ..::|.|     ...||         |:|.| ..||:|:
  Rat   309 GYGGY-------------GGYDYTG-----YNSYY---------GYGDY-SNQQSGY 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 32/76 (42%)
RRM2_hnRNPA_like 124..196 CDD:240774 31/71 (44%)
HnrnpdNP_077380.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 3/10 (30%)
CBFNT <55..76 CDD:285369
RRM1_hnRNPD_like 97..170 CDD:241019 29/72 (40%)
RRM2_hnRNPD 181..255 CDD:241027 32/73 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.