DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and hnrnpab

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:XP_012814656.1 Gene:hnrnpab / 734098 XenbaseID:XB-GENE-6042555 Length:326 Species:Xenopus tropicalis


Alignment Length:319 Identity:96/319 - (30%)
Similarity:146/319 - (45%) Gaps:48/319 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DVIVLADREEDDIC------ELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKR 71
            |.|..:..|||..|      .|....|:|:|||:..|::::||.::.::|:|.|..:..|..|.|
 Frog    40 DQINASKGEEDAGCVPDISSPLTEGVKMFVGGLSWDTSKKDLKDYFSKFGEVSDCTIKMDPNTGR 104

  Fly    72 SRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDE 136
            |||||||.:..:..||:..|.:.|.:||:.::.|:|:...:.       .:||:|||||.....|
 Frog   105 SRGFGFILFKDAASVDKVLEQKEHRLDGRLIDPKKAMAMKKD-------PIKKIFVGGLNPEAGE 162

  Fly   137 ECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVK----K 197
            :.:||||..||.:.:::|..|..|.|||||.|:.|.:.:.|.|.:.||.|.:.....::|    |
 Frog   163 DKIREYFETFGEIEAIELPMDPKTNKRRGFVFITFKEEEPVKKILEKKFHNVSGSKCEIKIAQPK 227

  Fly   198 SIYNLDKKEKQQPGGLANAIKPSLNQQQQQQGGGQQPPNGNMQAPSFRPPVPPQQAMGPYQQQPP 262
            .:|      :||.||...:.     ..:..:||..|..|.|....|:.......|..|.|.||. 
 Frog   228 EVY------QQQYGGRGGSF-----GGRGGRGGKAQGQNWNQGYNSYWNQGYGNQGYGGYGQQG- 280

  Fly   263 PAPMSAPPPNFNYWGPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPGAQQ 321
                .....|::|.|      ..||         |:||.....|...|....|..|:.|
 Frog   281 ----YGGYGNYDYSG------YGYY---------GYGPGYDYSQGSANYGKAPRRGSHQ 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 29/76 (38%)
RRM2_hnRNPA_like 124..196 CDD:240774 28/71 (39%)
hnrnpabXP_012814656.1 CBFNT 1..52 CDD:311868 5/11 (45%)
RRM1_hnRNPAB 66..140 CDD:241201 28/73 (38%)
RRM2_hnRNPAB 145..224 CDD:241028 30/85 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.