DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and SRSF2

DIOPT Version :10

Sequence 1:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_003007.2 Gene:SRSF2 / 6427 HGNCID:10783 Length:221 Species:Homo sapiens


Alignment Length:90 Identity:24/90 - (26%)
Similarity:44/90 - (48%) Gaps:4/90 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQE 91
            ::|.:..|.:..|...|:.:.|:..:.::|:|.||.:.||..||.||||.|:.:...    |..|
Human     9 DVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDK----RDAE 69

  Fly    92 NRPHIIDGKTVEAKRALPRPERESR 116
            :....:||..::.:....:..|..|
Human    70 DAMDAMDGAVLDGRELRVQMARYGR 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766
RRM_SF 33..110 CDD:473069 21/76 (28%)
SRSF2NP_003007.2 RRM_SRSF2_SRSF8 16..88 CDD:409751 21/75 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..221 1/3 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.