DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and hnrnpd

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001103930.1 Gene:hnrnpd / 560522 ZFINID:ZDB-GENE-070424-97 Length:314 Species:Danio rerio


Alignment Length:299 Identity:91/299 - (30%)
Similarity:140/299 - (46%) Gaps:74/299 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EEDDICELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLM 85
            |||:       .|:|:|||:..||:::||.::.::|:|||..:..|..|.|||||||:.:.::..
Zfish    50 EEDE-------GKMFVGGLSWDTTKKDLKDYFTKFGEVVDCTLKLDPLTGRSRGFGFVLFKEAES 107

  Fly    86 VDRAQENRPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVV 150
            |::....:.|.::||.::.|:|      ::.:|...|||:|||||..:..||.:||||..:|.|.
Zfish   108 VEKVITQKEHKLNGKVIDPKKA------KAMKTKEPVKKIFVGGLSPDTPEEKIREYFDAYGEVE 166

  Fly   151 SVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGLAN 215
            |::|..:..|.|||||.|:.|.:.:.|.|.:.|..|.|.....:||.::      .|:|      
Zfish   167 SIELPMENKTNKRRGFCFITFKEEEPVKKIMEKMYHNIGLSKCEVKVAM------SKEQ------ 219

  Fly   216 AIKPSLNQQQQQQGG---------GQQPPNGNMQAPSFRPPVPPQQAMGPYQQQPPPAPMSAPPP 271
                  .|||||.||         |:..||.|.           .|..|.|..|        ...
Zfish   220 ------YQQQQQWGGRGGYTSRGRGRGGPNQNW-----------NQGYGNYWNQ--------GYG 259

  Fly   272 NFNYWGPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWN 310
            |:..:|        |..|       |:|.|.....:|:|
Zfish   260 NYGNYG--------YNNQ-------GYGGYGGYDYSGYN 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 28/76 (37%)
RRM2_hnRNPA_like 124..196 CDD:240774 29/71 (41%)
hnrnpdNP_001103930.1 CBFNT 3..54 CDD:285369 3/10 (30%)
RRM1_hnRNPD_like 56..129 CDD:241019 26/72 (36%)
RRM2_hnRNPD 140..214 CDD:241027 31/73 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.