DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and RBM38

DIOPT Version :10

Sequence 1:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001278709.1 Gene:RBM38 / 55544 HGNCID:15818 Length:271 Species:Homo sapiens


Alignment Length:259 Identity:64/259 - (24%)
Similarity:94/259 - (36%) Gaps:71/259 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 PRP-----ERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAF 168
            |||     .....:.:.:..|:|||||..:..:..||:||..||::....::||:.|||.||:.|
Human    15 PRPLAAPGAMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGF 79

  Fly   169 -------------VEFD-------------------DYDAVDKAILKKQHAIKYVHVDVKKSIYN 201
                         :.||                   |..|.::| .|..:.|    :|.:|:..|
Human    80 GIIFVLEGHISQALNFDGRSWNPGGIFVGEPQVTMADRAAAERA-CKDPNPI----IDGRKANVN 139

  Fly   202 ---LDKKEKQQPGGLANAIK---PSLNQQQQQQGGGQQP----PNGNMQAPSFRPPVPPQQAMGP 256
               |..|.:....|.|..::   |:|.|:..    |..|    |...:|.....|..|......|
Human   140 LAYLGAKPRSLQTGFAIGVQQLHPTLIQRTY----GLTPHYIYPPAIVQPSVVIPAAPVPSLSSP 200

  Fly   257 YQQQPPPAPMSAPPPNFNYWGPPPPAMPPY------YQQPP--PQQMNGWGP-------YPPPQ 305
            |.:..|.:|..|..|...|...|..|.|..      |..|.  ||.::...|       |..||
Human   201 YIEYTPASPAYAQYPPATYDQYPYAASPATAASFVGYSYPAAVPQALSAAAPAGTTFVQYQAPQ 264

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766 28/103 (27%)