DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and msi1b

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001013534.1 Gene:msi1b / 541389 ZFINID:ZDB-GENE-050320-86 Length:330 Species:Danio rerio


Alignment Length:253 Identity:90/253 - (35%)
Similarity:125/253 - (49%) Gaps:34/253 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97
            |:|||||:..||:|.||.::.::|:|.:.:||||..|||||||||:|:.....||:......|.:
Zfish    21 KMFIGGLSWQTTQEGLKDYFCKFGEVKESMVMRDPVTKRSRGFGFVTFVDQAGVDKVLAQTRHEL 85

  Fly    98 DGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGK 162
            |.||::.|.|.||..:....|.  .||:|||||..|...|.:::||.|||.|....|:.||||.:
Zfish    86 DSKTIDPKVAFPRRAQPKLVTR--TKKIFVGGLSVNTTIEDVKQYFDQFGKVDDAMLMFDKTTNR 148

  Fly   163 RRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGLANAIKPSLNQQQQQ 227
            .|||.||.|::.|.|:|......|.|....|:.||:    ..||...|.|             ..
Zfish   149 HRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKA----QPKEVMSPTG-------------SS 196

  Fly   228 QGGGQQPPNGNMQA----------PSFRPPV---PPQQAMGP-YQQQPPPAPMSAPPP 271
            :|..:..|.| |.|          |.|:...   ....::.| |..|.|..|::|..|
Zfish   197 RGRARVMPYG-MDAFMLGIGMLGYPGFQATTYAGRSYTSLTPGYTYQFPAIPLTAYNP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 35/76 (46%)
RRM2_hnRNPA_like 124..196 CDD:240774 31/71 (44%)
msi1bNP_001013534.1 RRM <16..161 CDD:223796 64/141 (45%)
RRM1_MSI1 20..96 CDD:241203 34/74 (46%)
RRM2_MSI 110..183 CDD:240769 31/72 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.