DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and Hnrnpdl

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_057899.2 Gene:Hnrnpdl / 50926 MGIID:1355299 Length:420 Species:Mus musculus


Alignment Length:247 Identity:79/247 - (31%)
Similarity:123/247 - (49%) Gaps:47/247 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KDEPLSDESADV-----------------IVLADREEDDICELEHLRKLFIGGLAPYTTEENLKL 50
            :..||:|.||.:                 |..:..::||       .|:|||||:..|::::|..
Mouse   109 RQHPLADGSATMEDMNEYSNIEEFAEGSKINASKNQQDD-------GKMFIGGLSWDTSKKDLTE 166

  Fly    51 FYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKTVEAKRALPRPERES 115
            :..::|:|||..:..|..|.|||||||:.:..:..||:..|.:.|.:|||.::.|||.....:| 
Mouse   167 YLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAASVDKVLELKEHKLDGKLIDPKRAKALKGKE- 230

  Fly   116 RETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKA 180
                 ..||:|||||..:..||.::|||..||.:.:::|..|..|.:||||.|:.:.|.:.|.|.
Mouse   231 -----PPKKVFVGGLSPDTSEEQIKEYFGAFGEIENIELPMDTKTNERRGFCFITYTDEEPVKKL 290

  Fly   181 ILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGLANAIKPSLNQQQQQQGGGQ 232
            :..:.|.|.....::|.:          ||       |....||||||.||:
Mouse   291 LESRYHQIGSGKCEIKVA----------QP-------KEVYRQQQQQQKGGR 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 31/76 (41%)
RRM2_hnRNPA_like 124..196 CDD:240774 26/71 (37%)
HnrnpdlNP_057899.2 RRM1_hnRPDL 149..224 CDD:241202 30/74 (41%)
RRM2_hnRPDL 234..308 CDD:241029 27/73 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.