DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and hnrnpdl

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001011015.1 Gene:hnrnpdl / 496424 XenbaseID:XB-GENE-495016 Length:297 Species:Xenopus tropicalis


Alignment Length:184 Identity:66/184 - (35%)
Similarity:106/184 - (57%) Gaps:11/184 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97
            |:|||||:..|::::|..:..::|:|||..:..|..|.|||||||:.:..::.||:..|.:.|.:
 Frog    27 KMFIGGLSWDTSKKDLTEYLSRFGEVVDCTIKTDPVTGRSRGFGFVLFKDAVSVDKVLETKEHKL 91

  Fly    98 DGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGK 162
            |||.::.|||.....:|      ..||:|||||.....||.:::||..||.:.:::|..|..|.:
 Frog    92 DGKLIDPKRAKALKGKE------PPKKVFVGGLSPETTEEQIKQYFGGFGEIENIELPMDTKTNE 150

  Fly   163 RRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVK----KSIYNLDKKEKQQPGG 212
            ||||.||.:...:.|.|.:..:.|.|.....::|    |.:|. .:::|||.||
 Frog   151 RRGFCFVTYTGEEPVKKLLESRFHQIGTGKCEIKVAQPKEVYR-QQQQKQQKGG 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 31/76 (41%)
RRM2_hnRNPA_like 124..196 CDD:240774 25/71 (35%)
hnrnpdlNP_001011015.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
RRM1_hnRPDL 27..102 CDD:410152 30/74 (41%)
RRM2_hnRPDL 112..186 CDD:409998 26/73 (36%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..224 6/13 (46%)
Trnau1ap 222..>278 CDD:407550
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.