DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and snrnp70

DIOPT Version :10

Sequence 1:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001268699.1 Gene:snrnp70 / 493488 XenbaseID:XB-GENE-992818 Length:471 Species:Xenopus tropicalis


Alignment Length:161 Identity:38/161 - (23%)
Similarity:66/161 - (40%) Gaps:33/161 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GLAPYTTE-ENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHIIDGKT 101
            |:|||..| |:.:          |......|.|:..|    :...:...::|.|::         
 Frog    40 GIAPYIREFEDPR----------DAPPPTRAETREER----MERKRREKIERRQQD--------- 81

  Fly   102 VEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGF 166
            ||.:..:..|..:......:.|.|||..:..:..|..||..|..:|.:..:.::.:|.:||.||:
 Frog    82 VENELKIWDPHNDQNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYNKRSGKPRGY 146

  Fly   167 AFVEFDDYDAVDKAILKKQHAIKYVHVDVKK 197
            ||:|::....:..|         |.|.|.||
 Frog   147 AFIEYEHERDMHSA---------YKHADGKK 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766 20/71 (28%)
RRM_SF 33..110 CDD:473069 14/72 (19%)
snrnp70NP_001268699.1 U1snRNP70_N 3..94 CDD:432406 15/76 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..78 5/43 (12%)
Required for interaction with U1 RNA. /evidence=ECO:0000250|UniProtKB:P08621 92..202 23/86 (27%)
RRM_snRNP70 102..187 CDD:409682 23/76 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 187..471
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.