DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and trv

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001163754.3 Gene:trv / 43362 FlyBaseID:FBgn0085391 Length:651 Species:Drosophila melanogaster


Alignment Length:413 Identity:86/413 - (20%)
Similarity:133/413 - (32%) Gaps:130/413 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DREEDDICELEHLRKL------FIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGF 77
            |.|:.|. |:|::..|      |:|.|:.....:.|:..:..:|::.|..|:||..|.:|:|:||
  Fly   294 DMEDSDE-EMEYMPPLHKQFHIFVGDLSSEIETQQLREAFTPFGEISDCRVVRDPQTLKSKGYGF 357

  Fly    78 ITYTKSLMVDRA-QENRPHIIDGKTVEAKRALPRPE---------------RESRETNISVKKLF 126
            :::.|....:.| .......:..:::....|..:|.               .:|..:|.:|   :
  Fly   358 VSFIKKSEAESAITAMNGQWLGSRSIRTNWATRKPPASKENIKPLTFDEVYNQSSPSNCTV---Y 419

  Fly   127 VGGLKD---NHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAI 188
            |||:..   ...||.|::.|..:|.:..:::..||      |:|||.|...:|.       .|||
  Fly   420 VGGVNSALTALSEEVLQKTFAPYGAIQEIRVFKDK------GYAFVRFSTKEAA-------THAI 471

  Fly   189 KYVH------VDVKKSIYNLDKKEKQQPGGLANAIKPSLNQQQQQQGGGQQPPNGNMQAPSFRPP 247
            ..||      ..||.|.    .||...|.........:||.......|             |...
  Fly   472 VGVHNTEINAQPVKCSW----GKESGDPNNAQTIATQALNSAAAAAAG-------------FPYG 519

  Fly   248 VPPQQAMGPYQQQPPPAPMSAPPPNFNYWGPPPPAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAP 312
            |....|...|.||     ::|.    ..|..|.|.                  ||..........
  Fly   520 VGAAAAAAAYGQQ-----LAAT----GCWYSPTPT------------------YPASSATAAAVT 557

  Fly   313 PPPP----------PGAQQWHANQWGCPPPVQQVPPVGAVPPPMGHNGPPPTAPGNWNMPPPVPG 367
            |...          .|.|.:|..|:|   ..||           |:.|.....|..|        
  Fly   558 PAAASAAAVQNQFLQGIQGYHFGQYG---GYQQ-----------GYMGMGVQIPATW-------- 600

  Fly   368 AAPPSHQQQSSQQPTPQPNFGTG 390
                  |..:..|.:|.....||
  Fly   601 ------QGVTQAQISPAQQLATG 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 18/83 (22%)
RRM2_hnRNPA_like 124..196 CDD:240774 21/80 (26%)
trvNP_001163754.3 RRM2_TIA1_like 313..387 CDD:240799 16/73 (22%)
RRM3_TIA1_like 416..491 CDD:240800 25/94 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.