DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and Syp

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001262777.1 Gene:Syp / 42460 FlyBaseID:FBgn0038826 Length:761 Species:Drosophila melanogaster


Alignment Length:379 Identity:81/379 - (21%)
Similarity:128/379 - (33%) Gaps:143/379 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTK-------- 82
            ||      :|.|.:.....|:.|...:...|.:.|:.:|.|..|..:||:.|:|:|.        
  Fly   206 CE------VFCGKIPKDMYEDELIPLFENCGIIWDLRLMMDPMTGTNRGYAFVTFTNREAAVNAV 264

  Fly    83 -----------------------SLMVDRAQENRPH-----------------II----DGKTVE 103
                                   .|.|....:||..                 ||    |.|...
  Fly   265 RQLNDFEIRTGKKIGVTISFNNHRLFVGNIPKNRDRDELIEEFSKHAPGLYEVIIYSSPDDKKKN 329

  Fly   104 ----------------AKRAL----------------PRPERESRETNIS-VKKLFVGGLKDNHD 135
                            |||.|                ..|:.|..|..:| ||.|:|..|..:..
  Fly   330 RGFCFLEYESHKAASLAKRRLGTGRIKVWGCDIIVDWADPQEEPDEQTMSKVKVLYVRNLTQDVS 394

  Fly   136 EECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKA---ILKKQHAIKYVHVDVKK 197
            |:.|:|.|.|:|.|..||.:.|        :||:.|:|.|:..:|   :..|:.....:.|.:.|
  Fly   395 EDKLKEQFEQYGKVERVKKIKD--------YAFIHFEDRDSAVEAMRGLNGKEIGASNIEVSLAK 451

  Fly   198 SIYNLDKKEKQQPGGLANAIKPSLNQQQQQQGGGQQPPNGNMQAPSFRPPVPPQQAMGPYQQQPP 262
            .  ..|||:|::          .|..::::.          ||....||.:...:.:.||:...|
  Fly   452 P--PSDKKKKEE----------ILRARERRM----------MQMMQARPGIVGFETLSPYRNLSP 494

  Fly   263 --PAPMSAPPPNFNYWGPPPPAMPPYYQQPPPQQMN------GWGPYPPPQQNG 308
              |:.||..|..      |...||  .:.|.|::.:      |:..|   :|.|
  Fly   495 THPSIMSLTPMR------PGARMP--LRTPIPREYDYFYDFFGFSDY---RQGG 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 26/160 (16%)
RRM2_hnRNPA_like 124..196 CDD:240774 21/74 (28%)
SypNP_001262777.1 RRM1_hnRNPR_like 205..283 CDD:240695 16/82 (20%)
RRM2_hnRNPR_like 286..367 CDD:240696 12/80 (15%)
RRM3_hnRNPR_like 381..452 CDD:240697 23/78 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463962
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.