DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and CG5213

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_650473.1 Gene:CG5213 / 41892 FlyBaseID:FBgn0038345 Length:251 Species:Drosophila melanogaster


Alignment Length:240 Identity:59/240 - (24%)
Similarity:99/240 - (41%) Gaps:45/240 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LEHLR---KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRA 89
            |.:||   .|.:..|....||..|...:.::|::....::|...|..|..:||:.|........|
  Fly    34 LPNLRMKTNLILNYLPQDMTESELHRLFSKFGEIRKAKIIRHRRTGISCCYGFVDYVSERQAAAA 98

  Fly    90 QENRPHIIDGKTVEAKR---ALPRP-ERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVV 150
            ...    :||.....||   |..|| |.||..::     |:||.|....||:.:||.|..:||:|
  Fly    99 VNG----MDGYETRGKRLKVAFARPSEYESTSSS-----LYVGNLPTYMDEKKVRELFATYGNIV 154

  Fly   151 SVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGLAN 215
            .|.||..|...:.||.||::|:        :::          |.:.:.|.:|:..      :..
  Fly   155 DVNLLRHKFNNRSRGVAFLQFE--------LVR----------DAEVAKYGMDRYM------IEG 195

  Fly   216 AIKPSLNQQQQQQGGGQQPPNGNMQAPSFRPPVPPQQAMGPYQQQ 260
            |.:|...:..:::..|....:...|....|...||     ||:::
  Fly   196 ASRPLTVKFVEREKKGSSSTSSGSQYKDKRKSSPP-----PYKRR 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 18/79 (23%)
RRM2_hnRNPA_like 124..196 CDD:240774 22/71 (31%)
CG5213NP_650473.1 RRM1_Hu_like 41..117 CDD:240821 18/79 (23%)
RRM 128..202 CDD:214636 26/102 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.