DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and SLIRP2

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_649808.1 Gene:SLIRP2 / 41021 FlyBaseID:FBgn0037602 Length:91 Species:Drosophila melanogaster


Alignment Length:81 Identity:22/81 - (27%)
Similarity:44/81 - (54%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KLFIGGLAPYTT-EENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHI 96
            |||:|.| |:|. .:.|:.::.::|.|.:..|:.|.....|:.:||:.:::....:.|.....|.
  Fly    11 KLFVGNL-PWTIGSKELRTYFSKYGHVANAEVVFDRQLGLSKHYGFVVFSQRDAFNSASNQNTHF 74

  Fly    97 IDGKTVEAKRALPRPE 112
            :||:.:..:||...|:
  Fly    75 LDGRVLTVQRANESPQ 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 21/77 (27%)
RRM2_hnRNPA_like 124..196 CDD:240774
SLIRP2NP_649808.1 RRM_SLIRP 11..83 CDD:240688 19/72 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463958
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.