DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and hnrnpabb

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_998467.1 Gene:hnrnpabb / 406594 ZFINID:ZDB-GENE-040426-2516 Length:309 Species:Danio rerio


Alignment Length:233 Identity:82/233 - (35%)
Similarity:122/233 - (52%) Gaps:31/233 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 CELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQ 90
            || |...|:|:|||:..|::::||.::.::|:|:|..:..|:.|.||||||||.:.:|..|||..
Zfish    40 CE-EDAGKMFVGGLSWDTSKKDLKDYFSKFGEVMDCTIKMDSNTGRSRGFGFILFKESDSVDRVL 103

  Fly    91 ENRPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLL 155
            :.:.|.:||:.::.|||:...:.       .|||:|||||.....||.:||||..||.:.:::|.
Zfish   104 QQKEHRLDGRQIDPKRAMAIKKE-------PVKKIFVGGLNPETTEEKIREYFGSFGEIETIELP 161

  Fly   156 TDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVK----KSIYNLDKKEKQQ------- 209
            ||..|.|||||.|:.|.:..||.|.:.||.|.:.....::|    |.||     ::||       
Zfish   162 TDPKTSKRRGFVFITFKEEFAVKKILEKKYHNVCGSKCEIKIAQPKEIY-----QQQQFGARGGG 221

  Fly   210 -------PGGLANAIKPSLNQQQQQQGGGQQPPNGNMQ 240
                   .||...:.....|....|..|||....|..|
Zfish   222 FGGRGRGRGGPGQSWNQGYNNYWNQGYGGQGYGYGGQQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 31/76 (41%)
RRM2_hnRNPA_like 124..196 CDD:240774 31/71 (44%)
hnrnpabbNP_998467.1 CBFNT 2..45 CDD:285369 3/5 (60%)
RRM1_hnRNPAB 46..120 CDD:241201 29/73 (40%)
RRM_SF 125..204 CDD:302621 34/85 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.