DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and Slirp

DIOPT Version :10

Sequence 1:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_081234.2 Gene:Slirp / 380773 MGIID:1916394 Length:112 Species:Mus musculus


Alignment Length:75 Identity:22/75 - (29%)
Similarity:41/75 - (54%) Gaps:4/75 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 LREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVK----KSI 199
            |||:|.|||:|....:..||.||..||..:|:|...:.:..|:.::.|.|..|.:.|:    |::
Mouse    35 LREHFAQFGHVRRCTVPFDKETGFHRGMGWVQFSSQEELQNALQQEHHIIDGVKIHVQAQRAKAL 99

  Fly   200 YNLDKKEKQQ 209
            :.....::::
Mouse   100 HGAQTSDEER 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766 20/56 (36%)
RRM_SF 33..110 CDD:473069
SlirpNP_081234.2 RRM_SLIRP 21..92 CDD:409688 20/56 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.