DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and Hnrnpa3

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001104764.1 Gene:Hnrnpa3 / 362152 RGDID:727807 Length:379 Species:Rattus norvegicus


Alignment Length:463 Identity:139/463 - (30%)
Similarity:197/463 - (42%) Gaps:120/463 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EEDDICELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLM 85
            |..|..|.|.|||||||||:..||:::|:..:.:||.:.|.|||||..|||||||||:||:....
  Rat    24 EGHDPKEPEQLRKLFIGGLSFETTDDSLREHFEKWGTLTDCVVMRDPQTKRSRGFGFVTYSCVEE 88

  Fly    86 VDRAQENRPHIIDGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVV 150
            ||.|...|||.:||:.||.|||:.|.:......:::|||:||||:|::.:|..||:||.::|.:.
  Rat    89 VDAAMCARPHKVDGRVVEPKRAVSREDSVKPGAHLTVKKIFVGGIKEDTEEYNLRDYFEKYGKIE 153

  Fly   151 SVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGLAN 215
            :::::.|:.:||:||||||.|||:|.|||.:::|.|.|...:.:|||:   |.|:|.|..|    
  Rat   154 TIEVMEDRQSGKKRGFAFVTFDDHDTVDKIVVQKYHTINGHNCEVKKA---LSKQEMQSAG---- 211

  Fly   216 AIKPSLNQQQQQQGGGQQPPNGNMQAPSFRPPVPPQQAMGPYQQQPPPAPMSAPPPNFNYWGPPP 280
                    .|:.:|||    :||.....                    ........||...|   
  Rat   212 --------SQRGRGGG----SGNFMGRG--------------------GNFGGGGGNFGRGG--- 241

  Fly   281 PAMPPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPGAQQWHANQWGCPPPVQQVPPVGAVPPP 345
                         ...|.|.|     .|.........|......|.:|..               
  Rat   242 -------------NFGGRGGY-----GGGGGGSRGSYGGGDGGYNGFGGD--------------- 273

  Fly   346 MGHN---GPPPTAPGNWNMPPPVPGAAPPSHQQQSS---------QQPTPQPNFGTGYQQNYGGG 398
             |.|   ||..::.|.:       |...|.:..|..         .......|||.|   |||||
  Rat   274 -GGNYGGGPGYSSRGGY-------GGGGPGYGNQGGGYGGGGGGYDGYNEGGNFGGG---NYGGG 327

  Fly   399 PSKHNNMNANRMNPYSAGPPNSYHTPQPPAYTGYNAGPLPPNGSVPPPTGAKAVGVSNGSVATGG 463
            .      |.|....||....::|...:..::.|.::|         .|.|.   |..:|    ||
  Rat   328 G------NYNDFGNYSGQQQSNYGPMKGGSFGGRSSG---------SPYGG---GYGSG----GG 370

  Fly   464 SANSKYRR 471
            |.....||
  Rat   371 SGGYGSRR 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 42/76 (55%)
RRM2_hnRNPA_like 124..196 CDD:240774 31/71 (44%)
Hnrnpa3NP_001104764.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 4/10 (40%)
RRM1_hnRNPA_like 36..113 CDD:409992 42/76 (55%)
RRM2_hnRNPA3 126..205 CDD:409996 36/81 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..225 10/36 (28%)
HnRNPA1 332..>348 CDD:402981 3/15 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 335..379 14/60 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I8203
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1202220at2759
OrthoFinder 1 1.000 - - FOG0000779
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X431
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.