DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and Msi2

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:XP_038943587.1 Gene:Msi2 / 360596 RGDID:1560397 Length:354 Species:Rattus norvegicus


Alignment Length:414 Identity:117/414 - (28%)
Similarity:162/414 - (39%) Gaps:105/414 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97
            |:|||||:..|:.::|:.::.::|::.:.:||||..|||||||||:|:.....||:......|.:
  Rat    22 KMFIGGLSWQTSPDSLRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHEL 86

  Fly    98 DGKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGK 162
            |.||::.|.|.||..:....|.  .||:|||||..|...|.:::||.|||.|....|:.||||.:
  Rat    87 DSKTIDPKVAFPRRAQPKMVTR--TKKIFVGGLSANTVVEDVKQYFEQFGKVEDAMLMFDKTTNR 149

  Fly   163 RRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGLANAIKPSLNQQQQQ 227
            .|||.||.|::.|.|:|......|.|....|:.||:    ..||...|.|              .
  Rat   150 HRGFGFVTFENEDVVEKVCEIHFHEINNKMVECKKA----QPKEVMFPPG--------------T 196

  Fly   228 QGGGQQPP---------NGNMQAPSFRPPVPPQQAMGPYQQQPPPAPMSAPPPNFNYWGPPPPAM 283
            :|..:..|         .|.:..|:|         :..|.:   ..|..||...:.:     ||:
  Rat   197 RGRARGLPYTMDAFMLGMGMLGYPNF---------VATYGR---GYPGFAPSYGYQF-----PAL 244

  Fly   284 PPYYQQPPPQQMNGWGPYPPPQQNGWNAPPPPPPGAQQWHANQWGCPPPVQQVPPVGAVPPPMGH 348
            .||.....|....|                  |..|....|.:..........|..||...|.|.
  Rat   245 LPYLNASFPAAAYG------------------PVAAAAVAAARGSVLNSYSAQPNFGAPTSPAGS 291

  Fly   349 NGPPPTAPGNW---NMPPPVPGAAPPSHQQQ------SSQQPTPQPNFGTGYQQNYGGGPSKHNN 404
            |   |..||.:   |.|.||.....|:.|..      |:..|.|...||.|.             
  Rat   292 N---PARPGGFPGANSPGPVADLYGPASQDSGVGNYISAASPQPGSGFGHGI------------- 340

  Fly   405 MNANRMNPYSAGP------PNSYH 422
                      |||      .|.||
  Rat   341 ----------AGPLIATAFTNGYH 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 31/76 (41%)
RRM2_hnRNPA_like 124..196 CDD:240774 31/71 (44%)
Msi2XP_038943587.1 RRM1_MSI2 17..109 CDD:410153 34/88 (39%)
PABP-1234 <35..351 CDD:130689 107/396 (27%)
RRM2_MSI 111..184 CDD:240769 31/72 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.