DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and Pabp2

DIOPT Version :10

Sequence 1:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_476902.1 Gene:Pabp2 / 35788 FlyBaseID:FBgn0005648 Length:224 Species:Drosophila melanogaster


Alignment Length:113 Identity:26/113 - (23%)
Similarity:47/113 - (41%) Gaps:9/113 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 GKTVEAKRALPRPERESRETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKR 163
            |.:......:|....|.:|  |..:.::||.:......|.|..:|...|.:..|.:|.:|..|..
  Fly    74 GGSTTGLATVPLSLEEKQE--IDTRSVYVGNVDYGASAEELEAHFHGCGTINRVTILCNKADGHP 136

  Fly   164 RGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPG 211
            :|||::||...:.|:.|:...:...:...:.|.       .|...:||
  Fly   137 KGFAYIEFGSKEFVETALAMNETLFRGRQIKVM-------SKRTNRPG 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766 17/71 (24%)
RRM_SF 33..110 CDD:473069 1/10 (10%)
Pabp2NP_476902.1 DNA_pol_phi <3..68 CDD:461488
RRM_II_PABPN1 97..172 CDD:409966 18/81 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.