DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and Caper

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_609095.1 Gene:Caper / 33989 FlyBaseID:FBgn0031883 Length:594 Species:Drosophila melanogaster


Alignment Length:289 Identity:66/289 - (22%)
Similarity:109/289 - (37%) Gaps:77/289 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ADR--------EEDDICELEHLRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRG 74
            |||        ||.|      .|.:|...|:......:|:.|:...|||.||.::....|||.:|
  Fly   221 ADRTTPTELSPEERD------ARTVFCIQLSQRVRARDLEEFFSSVGKVRDVRLITCNKTKRFKG 279

  Fly    75 FGFITYTK------------------SLMVD--RAQENRPHIIDGKTVEAKRALPRPERESRETN 119
            ..:|.:..                  .:||.  :|::||          .:.|.|..:.:|   :
  Fly   280 IAYIEFDDPESVALALGLSGQRLLGVPIMVQHTQAEKNR----------LQNAAPAFQPKS---H 331

  Fly   120 ISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKK 184
            ....:|:||.|..|..|:.||..|..||.:.:::|:.|..||:.:|:.|:.:.:.|         
  Fly   332 TGPMRLYVGSLHFNITEDMLRGIFEPFGKIDAIQLIMDTETGRSKGYGFITYHNAD--------- 387

  Fly   185 QHAIKYVHVDVKKSIYNLDKKE----KQQPGGLANAI---KPSLNQQQQQQGGGQQPPNGNMQ-- 240
                     |.||::..|:..|    ..:.|.:...:   ..||:..:..:.|......|.:|  
  Fly   388 ---------DAKKALEQLNGFELAGRLMKVGNVTERLDMNTTSLDTDEMDRTGIDLGATGRLQLM 443

  Fly   241 ---APSFRPPVPPQQAMGPYQQQPPPAPM 266
               |......||...|.......|.|||:
  Fly   444 FKLAEGAGLAVPQAAANALLATAPQPAPL 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 20/96 (21%)
RRM2_hnRNPA_like 124..196 CDD:240774 19/71 (27%)
CaperNP_609095.1 RRM1_RBM39_like 238..310 CDD:240729 15/71 (21%)
RRM2_RBM23_RBM39 337..409 CDD:240730 23/89 (26%)
RBM39linker 425..500 CDD:292157 11/48 (23%)
RRM3_RBM39_like 483..567 CDD:240731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463936
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.