DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and DAZAP1

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:XP_011526206.1 Gene:DAZAP1 / 26528 HGNCID:2683 Length:550 Species:Homo sapiens


Alignment Length:451 Identity:159/451 - (35%)
Similarity:200/451 - (44%) Gaps:97/451 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 RKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHI 96
            ||||:|||...||:|.|:.::.|:|:|||.|:|:|..|.:||||||:.:.....|.....:|||.
Human   153 RKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLASRPHT 217

  Fly    97 IDGKTVEAKRALPR---PERE---------SRETNISVKKLFVGGLKDNHDEECLREYFLQFGNV 149
            :||:.::.|...||   |||.         .|..|....|:||||:..|..|..|||||.:||.|
Human   218 LDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVV 282

  Fly   150 VSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPGGLA 214
            ..|.::.|....:.|||.|:.|:|..:||:|:....|.|....|:||:: ...|.| .|.||   
Human   283 TEVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRA-EPRDSK-SQAPG--- 342

  Fly   215 NAIKPSLNQ------QQQQQGGGQQPPNGNMQAPSFRPP---VPPQQAMGPYQQQPPPAPMSAPP 270
               :|..:|      .....|...|||....|  .:.|.   ||..||:|.|  .||||...|| 
Human   343 ---QPGASQWGSRVVPNAANGWAGQPPPTWQQ--GYGPQGMWVPAGQAIGGY--GPPPAGRGAP- 399

  Fly   271 PNFNYWGPPPPAMPPYYQQPPPQQMNGWGPYPPPQ--QNGWNAPPP------PPPGAQQWHANQW 327
                   ||||....|....||      |.:||||  ..|:.|||.      |||          
Human   400 -------PPPPPFTSYIVSTPP------GGFPPPQGFPQGYGAPPQFSFGYGPPP---------- 441

  Fly   328 GCPPPVQQVPPVGAVPPPMGHNGPPPTAPGNWNMPPPVPGAAPPSHQQQSSQQPTPQPNFGTGYQ 392
              |||.|..||  .||||....|..|.|     .|||...|||     ..|:.||.||:|..|..
Human   442 --PPPDQFAPP--GVPPPPATPGAAPLA-----FPPPPSQAAP-----DMSKPPTAQPDFPYGQY 492

  Fly   393 QNYGGGPSKHNNMNANRMNPYSAGPPNSYHTPQPPAYTGYNAGPLPPNGSVPPPTGAKAVG 453
            ..||...|             ..|...|..:.|||:|    .||..| ||..||.|....|
Human   493 AGYGQDLS-------------GFGQGFSDPSQQPPSY----GGPSVP-GSGGPPAGGSGFG 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 32/76 (42%)
RRM2_hnRNPA_like 124..196 CDD:240774 29/71 (41%)
DAZAP1XP_011526206.1 RRM <151..341 CDD:223796 74/189 (39%)
RRM1_DAZAP1 154..235 CDD:241018 34/80 (43%)
RRM2_DAZAP1 254..333 CDD:240773 31/79 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56786
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.