DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and RBM24

DIOPT Version :10

Sequence 1:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001137414.1 Gene:RBM24 / 221662 HGNCID:21539 Length:236 Species:Homo sapiens


Alignment Length:141 Identity:39/141 - (27%)
Similarity:66/141 - (46%) Gaps:41/141 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97
            |:|:|||..:||:.:|:.::..:|::.:.||:.|..|.:|||:||:|     |.|||        
Human    12 KIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGFVT-----MADRA-------- 63

  Fly    98 DGKTVEAKRAL--PRPERESRETNISVKKL----------FVGGLKDNHDEECLREY-------- 142
                 .|:||.  |.|..:.|:.|:::..|          |..|::..|.....|.:        
Human    64 -----AAERACKDPNPIIDGRKANVNLAYLGAKPRIMQPGFAFGVQQLHPALIQRPFGIPAHYVY 123

  Fly   143 ---FLQFGNVV 150
               |:|.|.|:
Human   124 PQAFVQPGVVI 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766 9/48 (19%)
RRM_SF 33..110 CDD:473069 26/78 (33%)
RBM24NP_001137414.1 RRM_RBM24_RBM38_like 11..86 CDD:409818 30/91 (33%)
Necessary for interaction with EIF4E. /evidence=ECO:0000269|PubMed:29358667 175..199
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.