DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and Rbm3

DIOPT Version :10

Sequence 1:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_058089.2 Gene:Rbm3 / 19652 MGIID:1099460 Length:154 Species:Mus musculus


Alignment Length:88 Identity:32/88 - (36%)
Similarity:47/88 - (53%) Gaps:15/88 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHII 97
            |||:|||...|.|:.|:..:..:|.:.:|||::|..|:|||||||||:|          |..|..
Mouse     7 KLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFT----------NPEHAS 61

  Fly    98 DGKTVEAKRALPRPERESRETNI 120
            |     |.||:.....:.|:..:
Mouse    62 D-----AMRAMNGESLDGRQIRV 79

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766
RRM_SF 33..110 CDD:473069 31/76 (41%)
Rbm3NP_058089.2 RRM_CIRBP_RBM3 6..85 CDD:409883 32/88 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.