DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and hrpa-2

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_741783.1 Gene:hrpa-2 / 180791 WormBaseID:WBGene00019249 Length:336 Species:Caenorhabditis elegans


Alignment Length:239 Identity:77/239 - (32%)
Similarity:119/239 - (49%) Gaps:43/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LRKLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPH 95
            |||||||||:..||:|.|..::.|||.|||.:|:||..||.||||||:|:......:.|..:|||
 Worm    69 LRKLFIGGLSHDTTDEQLGNYFSQWGPVVDAIVIRDPNTKHSRGFGFVTFASIFSAESAMNDRPH 133

  Fly    96 IIDGKTVEAKRALPRPERESR------ETNISVK-KLFVGGLKDN-HDEECLREYFLQFGNVVSV 152
            .:.||||::|||:||.:..|.      ||:.:.. ||.:.|:.:. |..:.||.||..||.:..|
 Worm   134 KLGGKTVDSKRAIPREQMSSMIPPPFFETDPAPGCKLLLNGITNGVHSVDSLRVYFETFGTLDQV 198

  Fly   153 KLLTDKTTGKRRGFAFVEFDDYDAVDKAILKK--QHAIKYVHVDVK-------KSIY-------- 200
            ::|     |:.||..||.::|.::.|:.:...  :|.:....::|:       .|.|        
 Worm   199 EIL-----GQPRGLGFVIYEDKESADRCLAHNSGRHIVNERKIEVRVFTKHPNGSTYWKRPQSQS 258

  Fly   201 -------------NLDKKEKQQPGGLANAIKPSLNQQQQQQGGG 231
                         ||...:::..|..::|.....|..:....||
 Worm   259 HSQRDLFEQLSQLNLKDGDRKSTGNSSSAADTPQNFDEDSNYGG 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 40/76 (53%)
RRM2_hnRNPA_like 124..196 CDD:240774 20/74 (27%)
hrpa-2NP_741783.1 RRM <62..230 CDD:223796 66/165 (40%)
RRM1_hnRNPA_like 71..148 CDD:241022 40/76 (53%)
RRM_SF 183..240 CDD:302621 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 84 1.000 Domainoid score I5263
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.