DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and rbm-34

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_502291.1 Gene:rbm-34 / 178148 WormBaseID:WBGene00008688 Length:394 Species:Caenorhabditis elegans


Alignment Length:233 Identity:51/233 - (21%)
Similarity:93/233 - (39%) Gaps:45/233 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EHLRKLFIGGLAPYTTEENLKLFYGQWGKVVDV-----VVMRDAATKRSRGFGFITYTKSLMVDR 88
            |:...:|:|.:.....|::::..:..:|.:..|     :...:..|||      :|:....:.|:
 Worm   140 ENALTVFVGNMPLTMNEKSVRRIFSDFGTISSVRMRNLLPANEKLTKR------VTHLTGKLNDK 198

  Fly    89 AQENRPHIIDGKTVEAKRAL-----PRPERESRETNISVKK--------LFVGGLKDNHDEECLR 140
            ......::..|.....::||     ...:...|...:..||        :|||.|.....|:.|.
 Worm   199 QSSLTFYVKFGAEESVEKALKYNGTKLDDHVIRVDKVGSKKKEFGKDMAIFVGNLPFEITEDALI 263

  Fly   141 EYF-LQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKA-----------------ILKKQHA 187
            .:| .|.|.|.:|:::.||.|||.:|||||.|....:|..|                 ::||.|.
 Worm   264 TFFSAQIGPVEAVRIVRDKDTGKGKGFAFVNFKQDSSVSLALSMETIKMEKRDLRITKVMKKGHL 328

  Fly   188 IKYVHVDVKKSIYNLDKKEKQQPGGLANAIKPSLNQQQ 225
            .|   :...|...:..||.:.:..|..:..|.|..:::
 Worm   329 TK---IQTAKKRTSHGKKNQNEITGKLHKFKFSTKKER 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 13/86 (15%)
RRM2_hnRNPA_like 124..196 CDD:240774 29/97 (30%)
rbm-34NP_502291.1 RRM1_RBM34 144..233 CDD:240840 14/94 (15%)
RRM2_RBM34 247..320 CDD:240841 24/72 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.