DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and tdp-1

DIOPT Version :9

Sequence 1:NP_001014671.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001254189.1 Gene:tdp-1 / 174436 WormBaseID:WBGene00006514 Length:414 Species:Caenorhabditis elegans


Alignment Length:281 Identity:68/281 - (24%)
Similarity:116/281 - (41%) Gaps:63/281 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 LFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENR----- 93
            |.:.|:...||:|..:.::...|.||...:.| .:...|:||||:.     |....::|:     
 Worm   175 LIVLGVDFKTTDECFQKYFEDIGTVVFCEIKR-KSDGNSKGFGFVR-----MSSVGEQNKVLAIP 233

  Fly    94 PHIIDGKTVEAK----RALPRPERESRETNISVKKLFVGGLKDNHDEECLREYF-LQFGNVVSVK 153
            .|:|||:..:.|    |:|     :.::...|:.::|||.|.|..||..||:.| .:..:.:...
 Worm   234 QHMIDGRRCDVKVP
DGRSL-----QDKQGRPSISRIFVGRLTDKVDEHQLRKVFGDEAKSYIETA 293

  Fly   154 LLTDKTTGKR-RGFAFVEFDDYDAVDKAILKKQHAIKYVHVDVKKSIYNLDKKEKQQPG---GLA 214
            ::||....|. ||||||.....:|.::.:.|....:..:.|.:  ||....::..|..|   ||.
 Worm   294 VVTDVFIPKPFRGFAFVTLSSAEAAERIVSKGSLTVNGLSVGL--SIAQPREENNQSVGPDYGLP 356

  Fly   215 NAIKPSLNQQQQQQGGGQQPPNGNMQAPSFRPPVPPQQAMGPYQQQPPPAPMSAPPPNFNYWGPP 279
            ...:   |::::.                 ||...|.|     .:.|.|.|...||.:::     
 Worm   357 AGYR---NRRERD-----------------RPDRRPIQ-----NEAPLPMPFVRPPQDYS----- 391

  Fly   280 PPAMPPYYQQPPPQQMNGWGP 300
                  |.||..|.:...|.|
 Worm   392 ------YRQQNSPLERRYWAP 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_001014671.1 RRM1_hnRNPA_like 33..110 CDD:241022 23/84 (27%)
RRM2_hnRNPA_like 124..196 CDD:240774 22/73 (30%)
tdp-1NP_001254189.1 RRM_SF 174..247 CDD:302621 21/77 (27%)
RRM_SF 262..339 CDD:302621 23/78 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.