DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and Pabp2

DIOPT Version :10

Sequence 1:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:XP_061498749.1 Gene:Pabp2 / 1274794 VectorBaseID:AGAMI1_009745 Length:221 Species:Anopheles gambiae


Alignment Length:95 Identity:21/95 - (22%)
Similarity:42/95 - (44%) Gaps:7/95 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 ETNISVKKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAVDKAI 181
            :..:..:.::||.:......|.|..:|...|.:..|.:|.:|..|..:|||::||...:.|:.|:
Mosquito    87 KAEVDNRSIYVGNVDYGATAEELEAHFHGCGAINRVTILCNKADGHPKGFAYIEFGSKEFVETAL 151

  Fly   182 LKKQHAIKYVHVDVKKSIYNLDKKEKQQPG 211
            ...:...:...:.|       :.|...:||
Mosquito   152 AMNETLFRGRQIKV-------NPKRTNRPG 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766 17/71 (24%)
RRM_SF 33..110 CDD:473069
Pabp2XP_061498749.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.