DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and Cirbp

DIOPT Version :10

Sequence 1:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001366350.1 Gene:Cirbp / 12696 MGIID:893588 Length:176 Species:Mus musculus


Alignment Length:88 Identity:30/88 - (34%)
Similarity:54/88 - (61%) Gaps:7/88 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 KLFIGGLAPYTTEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRPHI- 96
            |||:|||:..|.|:.|:..:.::|::.:|||::|..|:|||||||:|:..   :|.|::....: 
Mouse     7 KLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFEN---IDDAKDAMMAMN 68

  Fly    97 ---IDGKTVEAKRALPRPERESR 116
               :||:.:...:|....:..||
Mouse    69 GKSVDGRQIRVDQAGKSSDNRSR 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766
RRM_SF 33..110 CDD:473069 28/80 (35%)
CirbpNP_001366350.1 RRM_CIRBP_RBM3 6..85 CDD:409883 28/80 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.