DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and Pabpn1

DIOPT Version :10

Sequence 1:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:XP_063129984.1 Gene:Pabpn1 / 116697 RGDID:619928 Length:320 Species:Rattus norvegicus


Alignment Length:55 Identity:19/55 - (34%)
Similarity:32/55 - (58%) Gaps:0/55 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 KKLFVGGLKDNHDEECLREYFLQFGNVVSVKLLTDKTTGKRRGFAFVEFDDYDAV 177
            :.::||.:......|.|..:|...|:|..|.:|.||.:|..:|||::||.|.::|
  Rat   168 RSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESV 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766 19/54 (35%)
RRM_SF 33..110 CDD:473069
Pabpn1XP_063129984.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.