DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rb97D and SLIRP2

DIOPT Version :10

Sequence 1:NP_524520.1 Gene:Rb97D / 43231 FlyBaseID:FBgn0004903 Length:471 Species:Drosophila melanogaster
Sequence 2:XP_003435781.1 Gene:SLIRP2 / 11175582 VectorBaseID:AGAMI1_013466 Length:93 Species:Anopheles gambiae


Alignment Length:78 Identity:26/78 - (33%)
Similarity:48/78 - (61%) Gaps:2/78 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 LRKLFIGGLAPYT-TEENLKLFYGQWGKVVDVVVMRDAATKRSRGFGFITYTKSLMVDRAQENRP 94
            ::|||:|.| |:| :.:.||.::.::|.|....|:.|.:|..|||:|||.::.......|..||.
Mosquito    15 VQKLFVGNL-PWTVSTKELKTYFSKYGHVHSTNVIYDKSTGISRGYGFIVFSTREGFTNATNNRL 78

  Fly    95 HIIDGKTVEAKRA 107
            |:::|:.::.:.|
Mosquito    79 HVLEGRVLDLQPA 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rb97DNP_524520.1 RRM2_hnRNPA_like 124..196 CDD:409766
RRM_SF 33..110 CDD:473069 26/76 (34%)
SLIRP2XP_003435781.1 RRM_SF 17..89 CDD:473069 25/72 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.