DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPARC and SPOCK1

DIOPT Version :9

Sequence 1:NP_001262998.1 Gene:SPARC / 43230 FlyBaseID:FBgn0026562 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_004589.1 Gene:SPOCK1 / 6695 HGNCID:11251 Length:439 Species:Homo sapiens


Alignment Length:305 Identity:64/305 - (20%)
Similarity:110/305 - (36%) Gaps:84/305 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DLLDEDLDLSDIDENEEEFLRLLEEKNKIKDIER-ENEIATKLAEVQHNLLNPVVEVDLCETMSC 90
            :.||.|..||.:.:.:.:     :..|:.:|.:. .|....|..:   ..|:|  ..|.|..:.|
Human    37 NFLDNDQWLSTVSQYDRD-----KYWNRFRDDDYFRNWNPNKPFD---QALDP--SKDPCLKVKC 91

  Fly    91 GAGRICQMHD-EKPKCV---------------------------CIPECPEEVDTRRLVCTNTNE 127
            ...::|...| :...||                           |.| ||  |....:||.:...
Human    92 SPHKVCVTQDYQTALCVSRKHLLPRQKKGNVAQKHWVGPSNLVKCKP-CP--VAQSAMVCGSDGH 153

  Fly   128 TWPSDCSVYQQRC--------WCDSGEPGCTNPDNAHMHIDYYGACH--EPRSCEGEDLKDFPRR 182
            ::.|.|.:....|        .||...|....|:...         |  |..:|..::|::...|
Human   154 SYTSKCKLEFHACSTGKSLATLCDGPCPCLPEPEPPK---------HKAERSACTDKELRNLASR 209

  Fly   183 MRDWLFNVMRDLAERDELTEHYMQMELEAETNNSR--RWSNAAV--------WKWCDLDGDTDRS 237
            ::|| |..:.:.|.|          .::..::|:.  |:..:.:        |.:..||.:.|..
Human   210 LKDW-FGALHEDANR----------VIKPTSSNTAQGRFDTSILPICKDSLGWMFNKLDMNYDLL 263

  Fly   238 VSRHELFPIRAPLVSLEHCIAPFLESCDSNKDHRITLVEWGACLE 282
            :...|:..|.  |...|.||.|...||||.||.:::..||..|.:
Human   264 LDPSEINAIY--LDKYEPCIKPLFNSCDSFKDGKLSNNEWCYCFQ 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPARCNP_001262998.1 FSL_SPARC 85..168 CDD:238649 21/120 (18%)
SPARC_Ca_bdg 169..278 CDD:287550 28/118 (24%)
SPARC_EC 170..292 CDD:238155 30/123 (24%)
SPOCK1NP_004589.1 Kazal_2 139..178 CDD:284958 9/40 (23%)
SPARC_Ca_bdg 196..302 CDD:287550 28/118 (24%)
SPARC_EC 197..315 CDD:238155 30/123 (24%)
TY 312..372 CDD:238114
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..439
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.