DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPARC and spock3

DIOPT Version :9

Sequence 1:NP_001262998.1 Gene:SPARC / 43230 FlyBaseID:FBgn0026562 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_009305894.1 Gene:spock3 / 562002 ZFINID:ZDB-GENE-090311-24 Length:389 Species:Danio rerio


Alignment Length:235 Identity:49/235 - (20%)
Similarity:83/235 - (35%) Gaps:62/235 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 DLCETMSCGAGRICQMHD-EKPKCV------------------CIPECPEEVDTRRLVCTNTNET 128
            |.|..:.||..::|...| :.|.||                  | ..||  |.....:|.....|
Zfish    64 DPCLKIKCGRHKVCVAEDYQTPTCVSQRRMSFKDMNLNSPLLKC-KRCP--VVHPSPICGTDGHT 125

  Fly   129 WPSDCSVYQQ--------------RCWCDSGEPGCTNPDNAHMHIDYYGACHEPRSCEGEDLKDF 179
            :.:.|.:..|              :|.|..|.|.                  |.|.|...::.:.
Zfish   126 YSTKCKLEYQACISGKQISVKCPGQCPCAPGNPA------------------EKRECGNAEMTEV 172

  Fly   180 PRRMRDWLFNVMRDLAERDELTEHYMQMELEAETNNSR--RWSNAAVWKWCDLDGDTDRSVSRHE 242
            ..|:|:|:    ..|.|.....:.|...:.|.:.:.|:  ...::..|.:..||.:.|..:.:.|
Zfish   173 VSRLREWI----TVLHESGNTNKKYKFQKPEKKVDMSKVPLCKDSLGWMFSRLDTNFDLHLDQSE 233

  Fly   243 LFPIRAPLVSLEHCIAPFLESCDSNKDHRITLVEWGACLE 282
            |..:.:.  ..:.|...||.|||.|:|..::..||.:|.:
Zfish   234 LSSLNSE--KSDVCTKAFLRSCDPNRDRLVSSQEWCSCFQ 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPARCNP_001262998.1 FSL_SPARC 85..168 CDD:238649 20/115 (17%)
SPARC_Ca_bdg 169..278 CDD:287550 25/110 (23%)
SPARC_EC 170..292 CDD:238155 26/115 (23%)
spock3XP_009305894.1 KAZAL 108..151 CDD:197624 7/44 (16%)
SPARC_Ca_bdg 162..267 CDD:287550 25/110 (23%)
SPARC_EC 163..279 CDD:238155 26/115 (23%)
TY 277..341 CDD:238114
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.