DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPARC and sparc

DIOPT Version :9

Sequence 1:NP_001262998.1 Gene:SPARC / 43230 FlyBaseID:FBgn0026562 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_989347.1 Gene:sparc / 394973 XenbaseID:XB-GENE-1009630 Length:300 Species:Xenopus tropicalis


Alignment Length:278 Identity:81/278 - (29%)
Similarity:121/278 - (43%) Gaps:44/278 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LLEEKNKIKDIERENEIATKLAEVQHNLLNPVVEVD--------LCETMSCGAGRICQMHDEK-P 103
            |.||:..|:|:..|..:.....:|:....:..|..:        .|....|..|::|::.:.. |
 Frog    24 LPEEEEVIEDVPTEETVGANPVQVEVGEFDDAVNEEEEEEPSENPCLNHHCKHGKVCEVDESNTP 88

  Fly   104 KCVC--IPECPEEVDTRRLVCTNTNETWPSDCSVYQQRCWCDSGEPGCTNPDNAH-MHIDYYGAC 165
            .|||  ...||..:.....||...|:|:.|.|..:..:|..:..:.|       | :|:||.|.|
 Frog    89 MCVCQDPSTCPSSLAEFEKVCGTDNKTYESSCHFFATKCTLEGTKKG-------HKLHLDYIGPC 146

  Fly   166 HEPRSCEGEDLKDFPRRMRDWLFNVMRDLAERDE----LTE---------HYMQMELEAETN--- 214
            .....|...:|.:||.||||||.||:..|.||||    |.|         |..:..|||..:   
 Frog   147 KYIAPCLDNELSEFPLRMRDWLKNVLVSLYERDENNNLLNEKQKLRVKKIHENEKRLEAGDHSME 211

  Fly   215 --------NSRRWSNAAVWKWCDLD-GDTDRSVSRHELFPIRAPLVSLEHCIAPFLESCDSNKDH 270
                    |...:.....|::..|| ...|..:|..||.|:||||:.:|||...|.:.||::.|.
 Frog   212 LLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELSPLRAPLIPMEHCTTRFFDECDTDNDK 276

  Fly   271 RITLVEWGACLELDPEDL 288
            .|.|.||..|..:..:|:
 Frog   277 YIALEEWAKCFGIKEQDV 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPARCNP_001262998.1 FSL_SPARC 85..168 CDD:238649 24/86 (28%)
SPARC_Ca_bdg 169..278 CDD:287550 46/133 (35%)
SPARC_EC 170..292 CDD:238155 49/144 (34%)
sparcNP_989347.1 FSL_SPARC 68..149 CDD:238649 24/87 (28%)
EFh_SPARC_SPARC 152..291 CDD:320014 48/138 (35%)
EF-hand motif 224..257 CDD:320014 11/32 (34%)
EF-hand motif 259..291 CDD:320014 12/31 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 74 1.000 Domainoid score I8999
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4642
OMA 1 1.010 - - QHG46414
OrthoDB 1 1.010 - - D1528521at2759
OrthoFinder 1 1.000 - - FOG0003487
OrthoInspector 1 1.000 - - oto103670
Panther 1 1.100 - - O PTHR13866
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2378
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.080

Return to query results.
Submit another query.