DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPARC and agr-1

DIOPT Version :9

Sequence 1:NP_001262998.1 Gene:SPARC / 43230 FlyBaseID:FBgn0026562 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001022152.3 Gene:agr-1 / 3565243 WormBaseID:WBGene00018304 Length:1473 Species:Caenorhabditis elegans


Alignment Length:156 Identity:38/156 - (24%)
Similarity:61/156 - (39%) Gaps:37/156 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 NKIKDIER----------ENEIATK--------LAEVQHNLLNPVVEVDLCETM-SCGAGRICQM 98
            |:.:|:.|          :||...|        :.:|:|   .....:.:|.|. ||...::|.:
 Worm   403 NRCEDVMRPVCATNGETFDNECEMKKKSCETKSMIKVKH---QGTCGIGVCATFDSCKKPQVCVV 464

  Fly    99 HDEKPKCVCIPECPEEVDTRRLVCTNTNETWPSDCSVYQQRCWCDSG-----EPGCTNPDNAHMH 158
            .|.|||||| |.|.:|.   :.||.:..:|:.::|.:....|.....     ...|.........
 Worm   465 VDGKPKCVC-PSCTDEF---KEVCGSDGKTYSNECRLQNAACMAQKNIFVKYNSACEACKLKKEK 525

  Fly   159 IDYYGAC----HEPRSCEGEDLKDFP 180
            .|:|.||    :|...|:..|  |.|
 Worm   526 CDFYSACVVGENEKAECKCPD--DCP 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPARCNP_001262998.1 FSL_SPARC 85..168 CDD:238649 25/92 (27%)
SPARC_Ca_bdg 169..278 CDD:287550 4/12 (33%)
SPARC_EC 170..292 CDD:238155 4/11 (36%)
agr-1NP_001022152.3 KAZAL 172..220 CDD:197624
KAZAL 251..301 CDD:197624
KAZAL 327..371 CDD:197624
KAZAL 400..445 CDD:197624 8/44 (18%)
KAZAL 472..516 CDD:197624 10/47 (21%)
KAZAL 547..592 CDD:197624 2/3 (67%)
KAZAL 612..660 CDD:197624
EGF_Lam 670..716 CDD:238012
EGF_Lam 722..>759 CDD:238012
KAZAL <819..852 CDD:197624
LamG 1081..1236 CDD:238058
LamG 1289..1450 CDD:238058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.