DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPARC and fstl1b

DIOPT Version :9

Sequence 1:NP_001262998.1 Gene:SPARC / 43230 FlyBaseID:FBgn0026562 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001034710.1 Gene:fstl1b / 324309 ZFINID:ZDB-GENE-030131-3029 Length:310 Species:Danio rerio


Alignment Length:255 Identity:52/255 - (20%)
Similarity:89/255 - (34%) Gaps:91/255 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 LCETMSCGAGRICQMHDE-KPKCVCIPECPEEVDTRRLVCTNTNETWPSDCSVYQQRCWCDSGEP 147
            :|..:.|||||.|.:::: :|.|:||.:|...   :|.||.:..:|:.:.|.:::..|.      
Zfish    29 VCANVFCGAGRECAVNEKGEPSCLCIEQCKTH---KRSVCGSNGKTYRNHCELHRDACL------ 84

  Fly   148 GCTNPDNAHMHIDYYGACHE---------PRSCEGEDLKDFPRRMRDWL---------------- 187
                 ....:.:.:.|.|.|         |..|...|..:..||:.:||                
Zfish    85 -----TGLKIQVAHDGHCKEKKKEKAAASPVVCYVADRNELRRRVIEWLQTEVVPDGWFTKGSNF 144

  Fly   188 -------------FNVMRDLAERDELTEH---YMQMELEAETNNSRRWSNAAVWKWCDLDGDTDR 236
                         .:...|.||..:..:|   .:||...||..|:|.                  
Zfish   145 TDILLKYFKNYDNGDSQLDSAELLKFIQHNETAVQMSSYAEEENNRL------------------ 191

  Fly   237 SVSRHELFPIRAPLVSLEHCIAPFLESCDSNKDHRITLVEWGACLE--LDPEDLKERCDD 294
                         |.||  |:...:|..|.|.|.:::..|:..||:  ..|.:.|...:|
Zfish   192 -------------LRSL--CVDALIELSDENADWKLSFDEFLNCLKPGFSPPEKKCALED 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPARCNP_001262998.1 FSL_SPARC 85..168 CDD:238649 21/92 (23%)
SPARC_Ca_bdg 169..278 CDD:287550 25/140 (18%)
SPARC_EC 170..292 CDD:238155 29/155 (19%)
fstl1bNP_001034710.1 FOLN 30..52 CDD:128570 8/21 (38%)
KAZAL_FS 57..97 CDD:238052 8/53 (15%)
EF-hand_7 148..218 CDD:290234 19/102 (19%)
EFh 148..218 CDD:298682 19/102 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.