DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPARC and Spock1

DIOPT Version :9

Sequence 1:NP_001262998.1 Gene:SPARC / 43230 FlyBaseID:FBgn0026562 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_038951544.1 Gene:Spock1 / 306759 RGDID:1311496 Length:444 Species:Rattus norvegicus


Alignment Length:319 Identity:67/319 - (21%)
Similarity:107/319 - (33%) Gaps:107/319 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 DLLDEDLDLSDI-------------DENEEEFLRLLEEKNKIKDIERENEIATKLAEVQHNLLNP 78
            :.||.|..||.:             ||.|:::.|   ..|..|..::              .|:|
  Rat    37 NFLDNDQWLSTVSQYDRDKYWNRFRDEVEDDYFR---NWNPNKPFDQ--------------ALDP 84

  Fly    79 VVEVDLCETMSCGAGRICQMHD-EKPKCV---------------------------CIPECPEEV 115
              ..|.|..:.|...::|...| :...||                           |.| ||  |
  Rat    85 --SKDPCLKVKCSPHKVCVTQDYQTALCVSRKHLLPRQKKGSVAHKHWVGPSNLVKCKP-CP--V 144

  Fly   116 DTRRLVCTNTNETWPSDCSVYQQRC--------WCDSGEPGCTNPDNAHMHIDYYGACHEPR--- 169
            ....:||.:...|:.|.|.:....|        .||...|....|:            .||:   
  Rat   145 AQSAMVCGSDGHTYTSKCKLEFHACSTGKSLSSLCDGPCPCLPEPE------------PEPQKPK 197

  Fly   170 ----SCEGEDLKDFPRRMRDWLFNVMRDLAERDELTEHYMQMELEAETNNSR-------RWSNAA 223
                :|..::|::...|::|| |..:.:.|.|       :.....::|...|       ...::.
  Rat   198 AEKSACTDKELRNLASRLKDW-FGALHEDANR-------VIKPTSSDTTQGRFDTSILPICKDSL 254

  Fly   224 VWKWCDLDGDTDRSVSRHELFPIRAPLVSLEHCIAPFLESCDSNKDHRITLVEWGACLE 282
            .|.:..||.:.|..:...|:..|.  |...|.||.|...||||.||.:::..||..|.:
  Rat   255 GWMFNKLDMNYDLLLDHSEINAIY--LDKYEPCIKPLFNSCDSFKDGKLSNNEWCYCFQ 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPARCNP_001262998.1 FSL_SPARC 85..168 CDD:238649 21/118 (18%)
SPARC_Ca_bdg 169..278 CDD:287550 28/122 (23%)
SPARC_EC 170..292 CDD:238155 30/120 (25%)
Spock1XP_038951544.1 Kazal_2 139..>176 CDD:400135 11/39 (28%)
EFh_SPARC_EC 203..314 CDD:330171 30/119 (25%)
EF-hand motif 250..281 CDD:320009 7/32 (22%)
EF-hand motif 282..314 CDD:320009 13/30 (43%)
TY 317..378 CDD:238114
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.