DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPARC and Fstl4

DIOPT Version :9

Sequence 1:NP_001262998.1 Gene:SPARC / 43230 FlyBaseID:FBgn0026562 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_017452742.1 Gene:Fstl4 / 303130 RGDID:1307227 Length:841 Species:Rattus norvegicus


Alignment Length:250 Identity:51/250 - (20%)
Similarity:78/250 - (31%) Gaps:108/250 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 CETMSCGAGRICQMHDE---KPKCVCIPEC-PEEVDTRRLVCTNTNETWPSDC------------ 133
            |....|..|..| :|:.   :|.|.|:..| |..:.    ||.:..:.:.:.|            
  Rat    64 CGKKLCSHGSRC-LHNRTTGQPLCHCLEVCRPRYMP----VCGSDGKLYGNHCELRRAACLLGKR 123

  Fly   134 --SVYQQRCWCDSGEPGCTNPDNAHMHIDYYGACHEPRSCEGEDLKDFPRRMRDWLFNVMRDLAE 196
              ||:.:.|:. .|:. ||....|.                              |.||:..|..
  Rat   124 IVSVHSKDCFL-KGDM-CTVAGYAR------------------------------LKNVLLALQS 156

  Fly   197 RDELTEHYMQMELEAETN-----NSRRWSNAAVWKWCDLDG-----------------DTDRSVS 239
            |        :..|:.||:     :.:|....:::|..|.||                 |.|.|::
  Rat   157 R--------RQPLQQETHRQSLASQKRLLVESLFKALDTDGNGRLGSLELAQYVLKEQDMDGSLN 213

  Fly   240 RHELFPIRAPLVSLEHCIAP--FLESCDSNKDHRITLVEWGAC-----LELDPED 287
            |               | :|  .|...|.|.|..:||.|:...     |.|.|||
  Rat   214 R---------------C-SPGDLLRFDDYNSDGSLTLGEFYTAFQVIQLSLAPED 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPARCNP_001262998.1 FSL_SPARC 85..168 CDD:238649 20/100 (20%)
SPARC_Ca_bdg 169..278 CDD:287550 26/132 (20%)
SPARC_EC 170..292 CDD:238155 30/146 (21%)
Fstl4XP_017452742.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.