DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPARC and Fs

DIOPT Version :9

Sequence 1:NP_001262998.1 Gene:SPARC / 43230 FlyBaseID:FBgn0026562 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_652376.2 Gene:Fs / 2768836 FlyBaseID:FBgn0259878 Length:767 Species:Drosophila melanogaster


Alignment Length:161 Identity:39/161 - (24%)
Similarity:61/161 - (37%) Gaps:35/161 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 CETMSCGAGRICQMHDE--KPKCV-CIPECPEE--------VDTRRLVCTNTNETWPSDCSVYQQ 138
            |..:.|..|..| :.|:  .|.|: |..|||.:        .|.|:.||....:|:.|.|.:  .
  Fly   608 CSGVHCLNGLTC-VEDQYLMPHCIACRIECPWDNLDVDSSGYDERQAVCGVDGKTYRSACDI--N 669

  Fly   139 RCWCDSGEPGCTNPDNAHMHIDYYGACHEPR-SCEGEDLKDFPRRMRDWLFNVMRDLAERDE--L 200
            |..|..|.         .:.:.|.|.|...| ||  .|:|..|:.      |.:.||..|..  :
  Fly   670 RMICKIGR---------SIAVAYPGPCRAGRVSC--ADIKCGPKD------NCLVDLQTRQPRCV 717

  Fly   201 TEHY-MQMELEAETNNSRRWSNAAVWKWCDL 230
            |..| ...:.:...:....::|.....||::
  Fly   718 TCRYKCPRKQQRPVHKICGYNNQTYNSWCEM 748

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPARCNP_001262998.1 FSL_SPARC 85..168 CDD:238649 24/93 (26%)
SPARC_Ca_bdg 169..278 CDD:287550 15/66 (23%)
SPARC_EC 170..292 CDD:238155 14/64 (22%)
FsNP_652376.2 KAZAL 564..604 CDD:197624
KAZAL_FS 654..687 CDD:238052 10/43 (23%)
KAZAL_FS 723..767 CDD:238052 3/26 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4004
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.