DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPARC and FSTL4

DIOPT Version :9

Sequence 1:NP_001262998.1 Gene:SPARC / 43230 FlyBaseID:FBgn0026562 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_055897.1 Gene:FSTL4 / 23105 HGNCID:21389 Length:842 Species:Homo sapiens


Alignment Length:319 Identity:63/319 - (19%)
Similarity:99/319 - (31%) Gaps:108/319 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 WL---LLGLGL-LAVSHVQASTEFSEDLLDEDLDLSDIDENEEEFLRLLEEKNKIKDIERENEIA 65
            ||   |||..| .|:..:...|....|:        .:.|::.|..|..|...: :.:...||:.
Human     7 WLHLTLLGASLPAALGWMDPGTSRGPDV--------GVGESQAEEPRSFEVTRR-EGLSSHNELL 62

  Fly    66 TKLAEVQHNLLNPVVEVDLCETMSCGAGRICQMHDE--KPKCVCIPEC-PEEVDTRRLVCTNTNE 127
            ..                 |....|..|..|.:..:  :|:|.|:..| |..|.    ||.:...
Human    63 AS-----------------CGKKFCSRGSRCVLSRKTGEPECQCLEACRPSYVP----VCGSDGR 106

  Fly   128 TWPSDCSVYQQRCW------------CDSGEPGCTNPDNAHMHIDYYGACHEPRSCEGEDLKDFP 180
            .:.:.|.:::..|.            |......||....|                         
Human   107 FYENHCKLHRAACLLGKRITVIHSKDCFLKGDTCTMAGYA------------------------- 146

  Fly   181 RRMRDWLFNV---MRDLAERDELTEHYMQMELEAETNNSRRWSNAAVWKWCDLDGDTDRSVSRHE 242
             |:::.|..:   ::.|.|.|...:...|..|..|:            .:.|||.|.:..:|..|
Human   147 -RLKNVLLALQTRLQPLQEGDSRQDPASQKRLLVES------------LFRDLDADGNGHLSSSE 198

  Fly   243 LFPIRAPLVSLEHCIAPFLESC---------DSNKDHRITLVEWGAC-----LELDPED 287
            |    |..|..:..:...|..|         |.|.|..:||.|:...     |.|.|||
Human   199 L----AQHVLKKQDLDEDLLGCSPGDLLRFDDYNSDSSLTLREFYMAFQVVQLSLAPED 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPARCNP_001262998.1 FSL_SPARC 85..168 CDD:238649 18/97 (19%)
SPARC_Ca_bdg 169..278 CDD:287550 25/120 (21%)
SPARC_EC 170..292 CDD:238155 30/135 (22%)
FSTL4NP_055897.1 KAZAL_FS 93..133 CDD:238052 7/43 (16%)
EFh 180..250 CDD:298682 19/85 (22%)
IG_like 256..337 CDD:214653
IGc2 265..326 CDD:197706
I-set 341..430 CDD:254352
Ig2_Follistatin_like 358..433 CDD:143213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.