DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPARC and C08G9.2

DIOPT Version :9

Sequence 1:NP_001262998.1 Gene:SPARC / 43230 FlyBaseID:FBgn0026562 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_501249.1 Gene:C08G9.2 / 177545 WormBaseID:WBGene00015620 Length:2224 Species:Caenorhabditis elegans


Alignment Length:177 Identity:39/177 - (22%)
Similarity:58/177 - (32%) Gaps:60/177 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 RLLEEKNKIKDIERENEIATKLAEVQHNLLN----------PVVE---VDLCETMSC-GAGRICQ 97
            |:..|:.:| |:.||..:.||..   ||...          |:..   ||:|..::| .....||
 Worm   303 RISREQRRI-DMCREPRLCTKKC---HNQCTHGHVMDIFGCPIASCSCVDICRNVNCENTWEQCQ 363

  Fly    98 MHD---EKPKCVCIPEC---------PEEVDTR-RLVCTNTNETWPSDCSV--YQQRCWCDSGEP 147
            :.:   ..|.|:.:|.|         |..:... ..:|:...:.....||.  |....:|.||..
 Worm   364 LVEPDCANPPCLPVPRCLLNPCRHGPPSRLGNGITALCSIDKDCPEGTCSKIGYNGLGFCCSGPA 428

  Fly   148 GCTN-----------------PDNAHMHIDYYGACHEPRSCEGEDLK 177
            ..|.                 |||         :||....| .||.|
 Worm   429 SSTRDGRCPSQAADKLKCLIYPDN---------SCHSDHEC-SEDEK 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPARCNP_001262998.1 FSL_SPARC 85..168 CDD:238649 22/115 (19%)
SPARC_Ca_bdg 169..278 CDD:287550 4/9 (44%)
SPARC_EC 170..292 CDD:238155 4/8 (50%)
C08G9.2NP_501249.1 WAP 90..127 CDD:278522
WAP 201..243 CDD:278522
TY 249..308 CDD:238114 1/4 (25%)
WAP 434..478 CDD:278522 9/42 (21%)
WAP 522..554 CDD:278522
TY 577..619 CDD:214561
WAP 738..779 CDD:278522
TY 861..903 CDD:214561
WAP 1022..1065 CDD:278522
TY 1138..1205 CDD:238114
WAP 1430..1469 CDD:278522
TY 1475..1544 CDD:238114
TY 1705..1768 CDD:238114
Lustrin_cystein 1898..1940 CDD:291299
Kunitz_BPTI 1946..1997 CDD:278443
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.