DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPARC and Fstl1

DIOPT Version :9

Sequence 1:NP_001262998.1 Gene:SPARC / 43230 FlyBaseID:FBgn0026562 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_032073.2 Gene:Fstl1 / 14314 MGIID:102793 Length:306 Species:Mus musculus


Alignment Length:240 Identity:52/240 - (21%)
Similarity:100/240 - (41%) Gaps:39/240 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 HNLLNPVVEVDLCETMSCGAGRICQMHDE-KPKCVCIPECPEEVDTRRLVCTNTNETWPSDCSVY 136
            |....|..:..:|..:.|||||.|.:.:: :|.|:||.:|...   :|.||.:..:|:.:.|.::
Mouse    17 HGEEEPRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPH---KRPVCGSNGKTYLNHCELH 78

  Fly   137 QQRCWCDSGEPGCTNPDNAHMHIDYYGACHEPRS---------CEGEDLKDFPRRMRDWL-FNVM 191
            :..|...|           .:.:||.|.|.|.:|         |...:..:..||:..|| ..::
Mouse    79 RDACLTGS-----------KIQVDYDGHCKEKKSASPSASPVVCYQANRDELRRRLIQWLEAEII 132

  Fly   192 RD-----LAERDELTEHYMQMELEAETNNSRRWSNAAVWKWCDLDGDTDRSVSRHELFPIRAPLV 251
            .|     .:...|:.:.|    .::..|......::...|:.: ..:|..:::.:........|.
Mouse   133 PDGWFSKGSNYSEILDKY----FKSFDNGDSHLDSSEFLKFVE-QNETAINITTYADQENNKLLR 192

  Fly   252 SLEHCIAPFLESCDSNKDHRITLVEWGACL--ELDPEDLKERCDD 294
            ||  |:...:|..|.|.|.:::..|:..||  ..:|.:.|...:|
Mouse   193 SL--CVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALED 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPARCNP_001262998.1 FSL_SPARC 85..168 CDD:238649 23/83 (28%)
SPARC_Ca_bdg 169..278 CDD:287550 21/123 (17%)
SPARC_EC 170..292 CDD:238155 25/138 (18%)
Fstl1NP_032073.2 FOLN 29..51 CDD:128570 8/21 (38%)
KAZAL 52..96 CDD:197624 13/57 (23%)
EF-hand_7 147..218 CDD:290234 13/77 (17%)
EFh 147..218 CDD:298682 13/77 (17%)
VWC 231..>278 CDD:302663 1/5 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.