DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment SPARC and Fst

DIOPT Version :9

Sequence 1:	NP_001262998.1	Gene:	SPARC / 43230	FlyBaseID:	FBgn0026562	Length:	304	Species:	Drosophila melanogaster
Sequence 2:	NP_001288302.1	Gene:	Fst / 14313	MGIID:	95586	Length:	344	Species:	Mus musculus

Alignment Length:	90	Identity:	24/90 - (26%)
Similarity:	46/90 - (51%)	Gaps:	15/90 - (16%)

- Green bases have known domain annotations that are detailed below.

  Fly    83 DLCETMSCGAGRICQMHDE-KPKCVCIPECPEEVDTRRLVCTNTNETWPSDCSVYQQRCWCDSGE 146
            :.||.:.||.|:.|:|:.: ||:|||.|:| ..:..:..||....:|:.::|::.:.||
Mouse    93 ETCENVDCGPGKKCRMNKKNKPRCVCAPDC-SNITWKGPVCGLDGKTYRNECALLKARC------ 150

  Fly   147 PGCTNPDNAHMHIDYYGACHEPRSC 171
                 .:...:.:.|.|.|  .::|
Mouse   151 -----KEQPELEVQYQGKC--KKTC 168

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
SPARC	NP_001262998.1	FSL_SPARC	85..168	CDD:238649	23/83 (28%)
		SPARC_Ca_bdg	169..278	CDD:287550	1/3 (33%)
		SPARC_EC	170..292	CDD:238155	1/2 (50%)
Fst	NP_001288302.1	FOLN	95..116	CDD:370409	9/20 (45%)
		KAZAL	117..164	CDD:197624	12/58 (21%)
		FOLN	167..190	CDD:128570	1/2 (50%)
		KAZAL	192..239	CDD:197624
		KAZAL	270..316	CDD:197624
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	315..344
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910