DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPARC and Sparcl1

DIOPT Version :9

Sequence 1:NP_001262998.1 Gene:SPARC / 43230 FlyBaseID:FBgn0026562 Length:304 Species:Drosophila melanogaster
Sequence 2:NP_001345943.1 Gene:Sparcl1 / 13602 MGIID:108110 Length:650 Species:Mus musculus


Alignment Length:236 Identity:74/236 - (31%)
Similarity:109/236 - (46%) Gaps:38/236 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 CETMSCGAGRICQMHDE-KPKCVCIPECPEEVDTRRLV---CTNTNETWPSDCSVYQQRCWCDSG 145
            |....|..|.||:...: ||.|||  :.||.....:::   |...|:|:.|.|.::..:|..:..
Mouse   419 CTNFQCKRGHICKTDPQGKPHCVC--QDPETCPPAKILDQACGTDNQTYASSCHLFATKCRLEGT 481

  Fly   146 EPGCTNPDNAHMHIDYYGACHEPRSCEGEDLKDFPRRMRDWLFNVMRDLAE-------------- 196
            :.|      ..:.:||:|||....:|...::..||.||||||.|::..|.|              
Mouse   482 KKG------HQLQLDYFGACKSIPACTDFEVAQFPLRMRDWLKNILMQLYEPNPKHGGYLNEKQR 540

  Fly   197 -------RDE----LTEHYMQMELEAETNNSRRWSNAAVWKWCDLD-GDTDRSVSRHELFPIRAP 249
                   .||    ..:|.:::.|.....|...:.....|::.:|| ...||.::..||.|:||.
Mouse   541 SKVKKIYLDEKRLLAGDHPIELLLRDFKKNYHMYVYPVHWQFNELDQHPADRILTHSELAPLRAS 605

  Fly   250 LVSLEHCIAPFLESCDSNKDHRITLVEWGACLELDPEDLKE 290
            ||.:||||..|.|.||.|||..|||.|||.|..:..||:.|
Mouse   606 LVPMEHCITRFFEECDPNKDKHITLKEWGHCFGIKEEDIDE 646

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPARCNP_001262998.1 FSL_SPARC 85..168 CDD:238649 24/86 (28%)
SPARC_Ca_bdg 169..278 CDD:287550 44/134 (33%)
SPARC_EC 170..292 CDD:238155 50/147 (34%)
Sparcl1NP_001345943.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..352
MDN1 <60..317 CDD:227596
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 375..415
KAZAL_FS 419..498 CDD:412159 24/86 (28%)
EFh_SPARC_like 501..641 CDD:320010 47/139 (34%)
EF-hand motif 574..606 CDD:320010 10/31 (32%)
EF-hand motif 609..639 CDD:320010 18/29 (62%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849329
Domainoid 1 1.000 76 1.000 Domainoid score I8928
eggNOG 1 0.900 - - E1_KOG4004
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3438
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003487
OrthoInspector 1 1.000 - - otm43320
orthoMCL 1 0.900 - - OOG6_105759
Panther 1 1.100 - - LDO PTHR13866
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2812
SonicParanoid 1 1.000 - - X2378
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.730

Return to query results.
Submit another query.