DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPARC and smoc1

DIOPT Version :9

Sequence 1:NP_001262998.1 Gene:SPARC / 43230 FlyBaseID:FBgn0026562 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_021322766.1 Gene:smoc1 / 100529120 ZFINID:ZDB-GENE-110310-7 Length:516 Species:Danio rerio


Alignment Length:227 Identity:47/227 - (20%)
Similarity:73/227 - (32%) Gaps:68/227 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 IPECPEEVDT---------RRLV----CTNTNETWPSDCSVYQQRCWC---DSGEPGCTNPDNAH 156
            :|.|.:|..|         |..:    |.......|..|......|||   |:|.|         
Zfish   277 VPSCDQERQTAQDEARQNPREAIFIPDCGLQGLYKPVQCHQSTGYCWCVLVDTGRP--------- 332

  Fly   157 MHIDYYGACHEPRSCEGEDLKDFPRRMRDWLFNVMRDLAERDELT-------EHYMQMELEAETN 214
              |....|.::...|      |...|.||   ..|.|.....:||       ..::...|:|.|.
Zfish   333 --IPGTSARYKKPEC------DSAARSRD---TEMEDPFRDRDLTGCPEGKKVEFITSLLDALTT 386

  Fly   215 NSRRWSNAAV----------------------WKWCDLDGDTDRSVSRHELFPIRAPL---VSLE 254
            :..:..|:..                      |.:..||.:....:::.|:.|.:..:   ...:
Zfish   387 DMVQAINSPTPSGGGRFVEPDPSHTLEERVVHWYFAQLDNNGSHDINKKEMKPFKRYVKKKAKPK 451

  Fly   255 HCIAPFLESCDSNKDHRITLVEWGACLELDPE 286
            .|...|.:.||.|||..|:|.|...||.::.|
Zfish   452 RCARKFTDYCDLNKDKTISLQELKGCLGVNKE 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPARCNP_001262998.1 FSL_SPARC 85..168 CDD:238649 16/75 (21%)
SPARC_Ca_bdg 169..278 CDD:287550 28/140 (20%)
SPARC_EC 170..292 CDD:238155 31/149 (21%)
smoc1XP_021322766.1 KAZAL 41..85 CDD:197624
Thyroglobulin_1 120..183 CDD:306570
Thyroglob_assoc 201..270 CDD:318740
Thyroglobulin_1 280..345 CDD:306570 15/75 (20%)
EFh_SPARC_SMOC1 368..482 CDD:320019 21/113 (19%)
EF-hand motif 413..445 CDD:320019 5/31 (16%)
EF-hand motif 450..482 CDD:320019 12/31 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.