DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SPARC and smoc1

DIOPT Version :9

Sequence 1:NP_001262998.1 Gene:SPARC / 43230 FlyBaseID:FBgn0026562 Length:304 Species:Drosophila melanogaster
Sequence 2:XP_012823493.1 Gene:smoc1 / 100145733 XenbaseID:XB-GENE-989094 Length:491 Species:Xenopus tropicalis


Alignment Length:237 Identity:51/237 - (21%)
Similarity:78/237 - (32%) Gaps:71/237 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 SCGAGRICQMHDEK--PK-CVCIPEC-PEEVDTRRLVCTNTNETWPSDCSVYQQRCWC---DSGE 146
            ||...|...:.:.|  |: .:.|||| |..:..            |..|......|||   |:|.
 Frog   263 SCDQERQSALEEAKLNPRDGIVIPECAPGGLYK------------PVQCHQSTGYCWCVLVDTGR 315

  Fly   147 PGCTNPDNAHMHIDYYGACHEPRSCEGE------DLKDFPRRMRDWLFNVMRDLAE--------- 196
            |           :......:|...||.:      |.:|   ..:|      |:||.         
 Frog   316 P-----------LPGTSTRYETPVCESDARWKNTDAED---PFKD------RELAGCPEGKKLEF 360

  Fly   197 ----RDELTEHYMQMELEAETNNSRRWS----------NAAVWKWCDLDGDTDRSVSRHELFPIR 247
                .|.||...:|....|......|:|          ...:|.:..||.:....:::.|:.|.:
 Frog   361 ITSLLDALTTDMVQAINSAAPAAGGRFSEPDPNHTLEERVVLWYFSQLDSNGSEDINKKEMKPFK 425

  Fly   248 APL---VSLEHCIAPFLESCDSNKDHRITLVEWGACLELDPE 286
            ..:   ...:.|...|.:.||.|||..|:..|...||.:..|
 Frog   426 RYVKKKAKPKKCARRFTDYCDLNKDKSISFPELKGCLGVRKE 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SPARCNP_001262998.1 FSL_SPARC 85..168 CDD:238649 18/85 (21%)
SPARC_Ca_bdg 169..278 CDD:287550 29/140 (21%)
SPARC_EC 170..292 CDD:238155 32/149 (21%)
smoc1XP_012823493.1 KAZAL_FS 47..87 CDD:238052
Thyroglobulin_1 95..158 CDD:278514
Thyroglob_assoc 159..256 CDD:293205
TY 263..329 CDD:238114 19/88 (22%)
SPARC_EC <401..468 CDD:238155 17/67 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.